Protein Info for PS417_17900 in Pseudomonas simiae WCS417

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF12833: HTH_18" amino acids 225 to 305 (81 residues), 69.5 bits, see alignment E=2.5e-23 PF00165: HTH_AraC" amino acids 268 to 304 (37 residues), 37 bits, see alignment 2.8e-13

Best Hits

KEGG orthology group: None (inferred from 78% identity to pba:PSEBR_a2727)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UK85 at UniProt or InterPro

Protein Sequence (313 amino acids)

>PS417_17900 transcriptional regulator (Pseudomonas simiae WCS417)
MSIPQHAHDGLDTWNRELRAACGYFDTELAFNRSLFIGEIRDLPRGLALLRTNAGLIKRP
AHHADHDNDQDCFLISQRSGYSQIVQNGQALQLAPGEMLLMDSVGSIEITPFGLIEHASL
SLSRPQVCKHLGGDARAFGKISSTKACGRMLHVLMDQLCKDDTEDGAGEVEALQSAFVSL
LGSALEQGDECREGLALLQGNNLRSYVQKVIDESLSQPGLSPIGLANRLNISVRHLYRLF
EEQDDSVCRYIQRARLKRSADDLTNPFLRSESITSIAYKWGFTDSAHFSRSFKKQFEVSP
KDFRSSRMQAVGA