Protein Info for PS417_01780 in Pseudomonas simiae WCS417

Annotation: proline iminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 TIGR01249: prolyl aminopeptidase" amino acids 9 to 311 (303 residues), 433.4 bits, see alignment E=2.2e-134 PF00561: Abhydrolase_1" amino acids 36 to 296 (261 residues), 127 bits, see alignment E=1.6e-40 PF12697: Abhydrolase_6" amino acids 37 to 295 (259 residues), 54.2 bits, see alignment E=4.8e-18 PF12146: Hydrolase_4" amino acids 56 to 160 (105 residues), 38.3 bits, see alignment E=1.4e-13

Best Hits

Swiss-Prot: 55% identical to PIP_LEPBY: Probable proline iminopeptidase (pip) from Leptolyngbya boryana

KEGG orthology group: K01259, proline iminopeptidase [EC: 3.4.11.5] (inferred from 98% identity to pfs:PFLU0371)

Predicted SEED Role

"Proline iminopeptidase (EC 3.4.11.5)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 3.4.11.5)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.5

Use Curated BLAST to search for 3.4.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYR6 at UniProt or InterPro

Protein Sequence (323 amino acids)

>PS417_01780 proline iminopeptidase (Pseudomonas simiae WCS417)
MQTWYPQIKPHARHDLAVDDTHTLYVDESGSPEGLPVVFIHGGPGAGCDAQSRCYFDPNL
YRIVTFDQRGCGRSTPRASLENNTTWDLVADLERIREHLGIDKWVLFGGSWGSTLALAYA
QTHPERVHGLIVRGIFLARPQDIHWFYQEGASRLFPDYWQDYIAPIPPEERHDMIAAYHK
RLTGNDQIAQMHAAKAWSGWEGRMLGLCPSPQHVERFSEPQRALSIARIECHYFTNNSFL
EPNQLIRDMHKIAHLPGVIIHGRYDMICPLDNAWELHQAWPNSELQVIREAGHAASEPGI
TDALVRATSQMARRLLDLPPEEA