Protein Info for PS417_17860 in Pseudomonas simiae WCS417
Annotation: 2-oxo-hepta-3-ene-1,7-dioate hydratase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 72% identical to HPCG_ECOLX: 2-oxo-hept-4-ene-1,7-dioate hydratase (hpcG) from Escherichia coli
KEGG orthology group: K02509, 2-oxo-hept-3-ene-1,7-dioate hydratase [EC: 4.2.1.-] (inferred from 92% identity to pba:PSEBR_a2738)MetaCyc: 72% identical to 2-hydroxyhepta-2,4-dienedioate hydratase monomer (Escherichia coli C)
Predicted SEED Role
"2-oxo-hepta-3-ene-1,7-dioic acid hydratase (EC 4.2.-.-)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic amino acid degradation or Benzoate transport and degradation cluster or Central meta-cleavage pathway of aromatic compound degradation (EC 4.2.-.-)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Aminosugars metabolism
- Benzoate degradation via CoA ligation
- Benzoate degradation via hydroxylation
- Biosynthesis of type II polyketide backbone
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Fatty acid biosynthesis
- Limonene and pinene degradation
- Nucleotide sugars metabolism
- Phenylalanine, tyrosine and tryptophan biosynthesis
- Porphyrin and chlorophyll metabolism
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 4.2.1.-
Use Curated BLAST to search for 4.2.-.- or 4.2.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7U161 at UniProt or InterPro
Protein Sequence (267 amino acids)
>PS417_17860 2-oxo-hepta-3-ene-1,7-dioate hydratase (Pseudomonas simiae WCS417) MLDSQQILAAAANLDRAERSREQVRQFSLDYPGITIEDAYAIQRAWVAQKIKDGRTLKGH KIGLTSRAMQVSSNITEPDYGALLDDMFFDEGSDIPFERFIVPRVEVELAFILGKPLKGP NCTVFDVLDATEWVIPALEIIDARIQQVDPQTNATRKVFDTISDNAANAGVVLGGRAVRP TEIDLRKVPAVLYRNGVIEESGVSAAVLNHPAKGVAWLANKLAPHDVTLLPGQIILGGSF TRPVAARPGDTFHVDYDLLGSIACRFV