Protein Info for GFF3487 in Variovorax sp. SCN45

Annotation: InterPro IPR005806 COGs COG2146

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 PF00355: Rieske" amino acids 27 to 109 (83 residues), 70.5 bits, see alignment E=1.4e-23 PF19301: LigXa_C" amino acids 142 to 399 (258 residues), 95 bits, see alignment E=7.1e-31

Best Hits

KEGG orthology group: None (inferred from 96% identity to vpe:Varpa_0165)

Predicted SEED Role

"InterPro IPR005806 COGs COG2146"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>GFF3487 InterPro IPR005806 COGs COG2146 (Variovorax sp. SCN45)
MISAEQNDFITRVGPDAPAGKLLRRYWQPVALADELAGPRPVKPVKLMGQDFVLFRDESG
QLGMLDRDCPHRGADLAFGRLENGGIRCAFHGWLFDAKGNCLETPAEPATSKLCSRIKQS
AYPVVEKAGTIFAYIGEGEPPAFPDFDCFVAPDTHTFAFKGLFECNWLQALEVGIDPAHA
SYLHRFFEDEDTSESYGKQFRGASADSDMPITKVLREYDRPDISVESTDYGFRLKALRKL
SEDTTHVRVTNVVFPQAFVIPMSAEMTISQWHVPVDDTHCYWYAIFTSFTGPVDKQQMRD
QRLKLYELPDYTSRKNKRNNYGYSIEEQLTETYTGMGDDINVHDQWAVESQGAIQDRTRE
HLGSTDKGIVAYRRLLVKAIEATQAGETAPMLIDAAQASAMTGPPSIDGIGHNVSDEAAT
ETYWQEADRARRLKSDWASARLAA