Protein Info for PS417_17850 in Pseudomonas simiae WCS417

Annotation: 5-carboxymethyl-2-hydroxymuconate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02962: CHMI
  • amino acids 2 to 124 (123 residues), 165.8 bits, E=2.7e-53

Best Hits

Swiss-Prot: 65% identical to HPCD_ECOLX: 5-carboxymethyl-2-hydroxymuconate Delta-isomerase (hpcD) from Escherichia coli

KEGG orthology group: None (inferred from 90% identity to pba:PSEBR_a2740)

MetaCyc: 65% identical to 5-carboxymethyl-2-hydroxymuconate isomerase (Escherichia coli B)
5-carboxymethyl-2-hydroxymuconate Delta-isomerase. [EC: 5.3.3.10]

Predicted SEED Role

"5-carboxymethyl-2-hydroxymuconate delta-isomerase (EC 5.3.3.10)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic amino acid degradation or Central meta-cleavage pathway of aromatic compound degradation (EC 5.3.3.10)

MetaCyc Pathways

• 4-hydroxyphenylacetate degradation (5/8 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.3.3.10

Use Curated BLAST to search for 5.3.3.10

Sequence Analysis Tools

See A0A1N7UK75 at UniProt or InterPro

Protein Sequence (137 amino acids)

>PS417_17850 5-carboxymethyl-2-hydroxymuconate isomerase (Pseudomonas simiae WCS417)
MPHFIAEYTDNIERQADLPGLFEKVHRVLGDSGVFPLGGIRSRGVRLDTWRMADGKHDYA
FVHMTLKVGHGRDLSTRQAVAETVFAVITTHFAELQAQRLLALSFEMVELHAQLNFKQNN
VHAFLNNPTVSTDHATP