Protein Info for GFF3485 in Xanthobacter sp. DMC5

Annotation: Carnitine monooxygenase reductase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 PF00970: FAD_binding_6" amino acids 10 to 104 (95 residues), 21.4 bits, see alignment E=5.4e-08 PF00111: Fer2" amino acids 239 to 309 (71 residues), 50.6 bits, see alignment E=3.1e-17

Best Hits

Swiss-Prot: 42% identical to CNTB_ECOLI: Carnitine monooxygenase reductase subunit (yeaX) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 85% identity to xau:Xaut_3181)

MetaCyc: 52% identical to dimethylamine monooxygenase ferredoxin subunit (Methylocella silvestris)
RXN-12901 [EC: 1.14.13.238]

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1; Vanillate O-demethylase oxidoreductase (EC 1.14.13.-)" (EC 1.14.13.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.13.238

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>GFF3485 Carnitine monooxygenase reductase subunit (Xanthobacter sp. DMC5)
MTAAQPFSVRVREIVELAPSLKRFSFEPVHGGVFPTPPAGGHVLLTLRDGARVMKNAYSL
VSPPSERARYDIIVRLVAQSRGGSSYLHRRVAPGDVLEMANPVSLFPLISTAKKHLLIGG
GIGITPMLSFLPELKARGARFELHQLATLEEVPVFERLLAPYAAGEEIRVHGGGRAAFDL
AGLLSRQPLGTHVYVCGPHSLMDAVASTAAALGWPKTKVHKESFGGDVTGLPFRAVLRKS
GIEVEVGESQSLLEAIEAAGVDAPCLCRGGACGQCATPLVEGEAEHRDDFLSAEEKAAGT
LIMTCVSRARGPRIVIDL