Protein Info for GFF348 in Xanthobacter sp. DMC5

Annotation: Putative hydrolase MhqD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02230: Abhydrolase_2
  • amino acids 24 to 213 (190 residues), 31.7 bits, E=2.9e-11

Best Hits

Swiss-Prot: 46% identical to MHQD_BACSU: Putative hydrolase MhqD (mhqD) from Bacillus subtilis (strain 168)

KEGG orthology group: K06999, (no description) (inferred from 78% identity to xau:Xaut_3749)

Predicted SEED Role

"Carboxylesterase (EC 3.1.1.1)" (EC 3.1.1.1)

MetaCyc Pathways

• methylsalicylate degradation (2/2 steps found)
• aspartame degradation (1/2 steps found)
• methyl indole-3-acetate interconversion (1/2 steps found)
• superpathway of methylsalicylate metabolism (1/5 steps found)
• retinol biosynthesis (1/7 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis II
• Drug metabolism - other enzymes

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.1

Use Curated BLAST to search for 3.1.1.1

Protein Sequence (220 amino acids)

>GFF348 Putative hydrolase MhqD (Xanthobacter sp. DMC5)
MNALPATPAAPARGALSFTHRFVPATDPAAAPLLLLHGTGGDENDLIPLGRMLSPGAALL
SPRGKISEGGMPRFFRRLAEGVFDEEDVVRRAHELADFIGEARTAYGLAAPVAVGFSNGA
NIAAAMLMLRPEVLSGAALLRAMVPLANPPVGSLPGTPVLMLSGAADPIVPASNAARLAA
QLNERGARVEHRVLPGGHGLTPTDMTAMRDWLARTGAATA