Protein Info for GFF348 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 82 to 99 (18 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details PF20968: MASE8" amino acids 40 to 193 (154 residues), 38 bits, see alignment E=1.8e-13 PF02518: HATPase_c" amino acids 331 to 442 (112 residues), 82.1 bits, see alignment E=4.2e-27

Best Hits

KEGG orthology group: None (inferred from 56% identity to cti:RALTA_A2594)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>GFF348 Signal transduction histidine kinase (Hydrogenophaga sp. GW460-11-11-14-LB1)
LKMVDRPSSPYERQLSDFRLAYSKAGSITSIVLVLAGFGLDYFSYPERLLEFTLLRVLVV
LLTLGILRLLFTPFGRENVRSLTMLWLLLPQIMIAFMIYETDGAQSIYFVGLHLALYAVG
IILPISFFEGIGFGVVTLVLYVVACALHPDTADNTPRMVTNSLFILFSAGASAVCTWFNE
RARLRLFQLQHEVSEKNASLRDINNTLAEVKGQLLQREKMAAIGTLSAGLLHELNNPVNY
SLMAINMGLTCKGVQDDEMLKESLIDAREGMQRIQNIVTDLKTFAYQKPGQDSMRSFLLE
NAVRSAVRLAGYELKGIDVAVSLPQDSHVLGDEPAIIGVLINLLSNAALALQVAKREQPR
IAVTVTEGAQRVGVSVRDNGSGIAPDNLTRVFEPFFTTRDVGAGLGLGLSVSYGIVQRHG
GTLAVESEQGSWTEFTFDLPRPE