Protein Info for GFF3478 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF00044: Gp_dh_N" amino acids 3 to 102 (100 residues), 146 bits, see alignment E=3.9e-47 TIGR01534: glyceraldehyde-3-phosphate dehydrogenase, type I" amino acids 4 to 324 (321 residues), 448.7 bits, see alignment E=6.2e-139 PF02800: Gp_dh_C" amino acids 155 to 312 (158 residues), 241.5 bits, see alignment E=3.1e-76

Best Hits

Swiss-Prot: 100% identical to G3P_SALTI: Glyceraldehyde-3-phosphate dehydrogenase (gapA) from Salmonella typhi

KEGG orthology group: K00134, glyceraldehyde 3-phosphate dehydrogenase [EC: 1.2.1.12] (inferred from 99% identity to eco:b1779)

MetaCyc: 99% identical to glyceraldehyde-3-phosphate dehydrogenase A (Escherichia coli K-12 substr. MG1655)
Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). [EC: 1.2.1.12]

Predicted SEED Role

"NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Pyridoxin (Vitamin B6) Biosynthesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>GFF3478 NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTIKVGINGFGRIGRIVFRAAQKRSDIEIVAINDLLDAEYMAYMLKYDSTHGRFDGTVEV
KDGHLIVNGKKIRVTAERDPANLKWDEVGVDVVAEATGIFLTDETARKHITAGAKKVVLT
GPSKDNTPMFVKGANFDKYEGQDIVSNASCTTNCLAPLAKVINDNFGIIEGLMTTVHATT
ATQKTVDGPSHKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNVSV
VDLTVRLEKAATYEQIKAAVKAAAEGEMKGVLGYTEDDVVSTDFNGEVCTSVFDAKAGIA
LNDNFVKLVSWYDNETGYSNKVLDLIAHISK