Protein Info for GFF3474 in Variovorax sp. SCN45

Annotation: Alkyl sulfatase and related hydrolases, MBL-fold metallo-hydrolase superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 663 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00753: Lactamase_B" amino acids 125 to 350 (226 residues), 85.2 bits, see alignment E=1.2e-27 PF14863: Alkyl_sulf_dimr" amino acids 387 to 525 (139 residues), 195.8 bits, see alignment E=8.6e-62 PF14864: Alkyl_sulf_C" amino acids 534 to 656 (123 residues), 142.7 bits, see alignment E=1.5e-45 PF02036: SCP2" amino acids 567 to 645 (79 residues), 31.8 bits, see alignment E=3e-11

Best Hits

Swiss-Prot: 67% identical to BDS1_YEAST: Alkyl/aryl-sulfatase BDS1 (BDS1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: None (inferred from 88% identity to vpe:Varpa_0153)

Predicted SEED Role

"alkyl sulfatase (EC 3.1.6.-)" (EC 3.1.6.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.6.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (663 amino acids)

>GFF3474 Alkyl sulfatase and related hydrolases, MBL-fold metallo-hydrolase superfamily (Variovorax sp. SCN45)
MTSSFSRTAGLVALACMLGAPPVSAQTAAKSPEPATLQANADMAKTLPFADRRDFEDAMR
GFVATVPDALVPGTGPRPVWSMKPYDFLKADAPADTVNPSLWRQAQLNAIHGLFQVTERV
YQVRGFDLANMTIVEGDSSLIVIDPLLSAETARAALDLYYQHRPRKPVGTVIYTHGHVDH
FGGVKGVTTEADVAAGKVQVLAPAGFMETAVAENILAGNAMSRRSQYQFGTLLPPGVRGQ
VDTGLGKALARGTVTLIAPTASIEKPTESRTIDGVQFVFHLVPGSEAPSEMLMYLPQFRV
LNMAEDVTHNMHNLYTIRGAEVRDGNLWSKYIGEARVAFGGKADVLIAQHHWPTFGQERI
VDLLKKQRDMYKFINDQSLRLLNQGYTAADIAETLRMPASLAQEWSARGYYGTLRHNAKA
VYQKYLGWYDANPANLDPLPPVAYAKKTVEYMGGADAVIARAREDFRKGEFRWVASAMNQ
VVYADPSNRVARELGADALEQQGYQSEAGTWRSAYLVGAMELRNGVPKIPGGSSANADTL
KAVSNDLFFDFLGVRLDAAKAEGKKLVINWNFTDSNQQFVLTLENSALTHIAGQQPGADA
TVTLSRATLDAVTLKETSFPAAVLTGKVKIEGDRAKLAELMSMLDTFEPMFPVVEPRAQP
KNQ