Protein Info for GFF3474 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: MltA-interacting protein MipA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF06629: MipA" amino acids 28 to 248 (221 residues), 192.3 bits, see alignment E=6.5e-61

Best Hits

Swiss-Prot: 84% identical to MIPA_ECOLI: MltA-interacting protein (mipA) from Escherichia coli (strain K12)

KEGG orthology group: K07274, outer membrane protein (inferred from 99% identity to ses:SARI_01694)

MetaCyc: 84% identical to MltA-interacting protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"MltA-interacting protein MipA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>GFF3474 MltA-interacting protein MipA (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VTKLKLLALGVFIATSASVAHAESNLTLGAGVGVVEHPYKDYDSDVYPIPVIAYESENFW
FRGLGGGYYLWNDNADKLSIMAYWSPMYFKPGDSDDHQLRRLDRRKSTMMAGVSYAHHTQ
YGFLRTSLAGDTLDNSNGIVWDLAWLYRYTNGGLTLTPGIGVEWNSENQNDYYYGVSRKE
SSRSGLRGYNPNDSWNPYLELSANYNFAGNWSVYGTARYTRLSDEITDSPMVDKSWTGIL
STGVTYRF