Protein Info for GFF347 in Sphingobium sp. HT1-2

Annotation: Molybdenum ABC transporter permease protein ModB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details TIGR02141: molybdate ABC transporter, permease protein" amino acids 16 to 225 (210 residues), 224.6 bits, see alignment E=5.3e-71 PF00528: BPD_transp_1" amino acids 33 to 227 (195 residues), 60 bits, see alignment E=1.3e-20

Best Hits

Swiss-Prot: 60% identical to MODB_ECOLI: Molybdenum transport system permease protein ModB (modB) from Escherichia coli (strain K12)

KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 76% identity to sjp:SJA_C1-33080)

MetaCyc: 60% identical to molybdate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>GFF347 Molybdenum ABC transporter permease protein ModB (Sphingobium sp. HT1-2)
MLLSSISAEEWAIIGLSLRVSLTAVFAMLPIAFALAWLLARYRFPGKLMLDALVHLPLVV
PPVVTGWLLLLLFGRQGVFGYWLESWFGISLLFRWTGATLAAAIMAMPLMVRAIRLSIET
IDRRLEAVAQTLGAGRIRVFCTISLPLAVPGILAGMILGFARSIGEFGATITFVSDIPGE
TRTLPIAIYSALQLPDSENAVVRLALISIALSLGALMASEWLARRMGRGDHVL