Protein Info for GFF3454 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 153 to 179 (27 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details PF01810: LysE" amino acids 18 to 209 (192 residues), 180.8 bits, see alignment E=1.1e-57

Best Hits

Swiss-Prot: 100% identical to LEUE_SALTY: Leucine efflux protein (leuE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K11250, leucine efflux protein (inferred from 99% identity to sew:SeSA_A1359)

MetaCyc: 87% identical to leucine exporter (Escherichia coli K-12 substr. MG1655)
RXN0-7050; TRANS-RXN0-270

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>GFF3454 Putative transport protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VFAEYGVLNYWTYLVGAIFIVLVPGPNTLFVLKNSVGRGVKGGYLAACGVFIGDAILMFL
AYAGVATLIKTTPVLFNIVRYLGAFYLLYLGAKILYATLTSKGRAATETVVPFGAIFKRA
LILSLTNPKAILFYVSFFVQFIDVTAPHTGVSFFILATTLEIVSFCYLSFLILSGAFVTH
YIGTKKKLAKVGNSLIGLLFVGFAARLATLQS