Protein Info for PS417_17670 in Pseudomonas simiae WCS417

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 218 to 242 (25 residues), see Phobius details amino acids 255 to 280 (26 residues), see Phobius details amino acids 291 to 314 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 36 to 303 (268 residues), 128.5 bits, see alignment E=1.3e-41

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 97% identity to pfs:PFLU3984)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UN69 at UniProt or InterPro

Protein Sequence (336 amino acids)

>PS417_17670 ABC transporter permease (Pseudomonas simiae WCS417)
MSEKNPLPFAKTQSKAMLLWVLAVLIGLPLILPSATLATEILIFAMAALACNLLLGYTGL
LSFGQGIFFGAGAYCAALLMIHLQLGLFTALLGAAIAGGFLALLVGALAIRRTGIYFVML
TLAFSQMAYFVAYTLSDWTGGDNGLLSVPRPEIRLGETVLLSLADARAFYAFVAVLFLLI
FIGARRVIASPFGSTLMAIRENETRASAIGYDTRHFKILVFVLSGAVTGIAGALYAMLLH
FVPLSNIDLMMSENILIMTIVGGTGSLFGSLLGAGSIVLLGDFLSDLWPRWLMLLGVILI
LVVIFMRGGLWGGLVSLFERVRGSRKTAAVAKEEGL