Protein Info for PS417_17665 in Pseudomonas simiae WCS417

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 37 to 55 (19 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 223 to 251 (29 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 9 to 276 (268 residues), 124.8 bits, see alignment E=1.9e-40

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 99% identity to pfs:PFLU3983)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UHK9 at UniProt or InterPro

Protein Sequence (286 amino acids)

>PS417_17665 ABC transporter permease (Pseudomonas simiae WCS417)
MLNLYLFQILNGLGLGMIYFLISVGLTIIFGLLNFVNFAHGAFFLLGAYICYTAVSLTGN
FWLALLIAPLVVAALAWVIERVLIQRIYHLPHMFQILVTLGIALIIQEASVMIWGPVGKS
VAVPELLRGVLVVGDFVYPYYRLFLIVFSGLVGLGLWLLLERTRFGALVRAGSESTETVS
LLGTNIFRLFSMTFALGVALAGVAGVLFAPLRGAQPFVGPEILGVAFVVVVIGGMGSFSG
ALVGGLLVGVVQSLMTTLWPQGASLMIYGAMAVVILVRPYGLFGRA