Protein Info for GFF3451 in Sphingobium sp. HT1-2

Annotation: DNA topoisomerase IV subunit B (EC 5.99.1.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 659 TIGR01055: DNA topoisomerase IV, B subunit" amino acids 17 to 649 (633 residues), 767.8 bits, see alignment E=4.1e-235 PF02518: HATPase_c" amino acids 43 to 140 (98 residues), 55.6 bits, see alignment E=1.4e-18 PF00204: DNA_gyraseB" amino acids 239 to 408 (170 residues), 138.4 bits, see alignment E=3.6e-44 PF01751: Toprim" amino acids 438 to 549 (112 residues), 62.3 bits, see alignment E=7.9e-21 PF00986: DNA_gyraseB_C" amino acids 581 to 646 (66 residues), 83.7 bits, see alignment E=1.6e-27

Best Hits

Swiss-Prot: 60% identical to PARE_BARBK: DNA topoisomerase 4 subunit B (parE) from Bartonella bacilliformis (strain ATCC 35685 / NCTC 12138 / KC583)

KEGG orthology group: K02622, topoisomerase IV subunit B [EC: 5.99.1.-] (inferred from 92% identity to sch:Sphch_0383)

Predicted SEED Role

"Topoisomerase IV subunit B (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (659 amino acids)

>GFF3451 DNA topoisomerase IV subunit B (EC 5.99.1.3) (Sphingobium sp. HT1-2)
MSEDLFASAQSTTSPGYDASTIEVLEGLEPVRRRPGMYIGGIDERAFHHLASEVLDNSMD
EAVAGHATRIEISLEPGNKLTITDNGRGIPVDDHPKFPGKSALEVILTTLHSGGKFEGKA
YATSGGLHGVGISVVNALSIKTVIEVARNKELFRQSFSQGLPTSGLEKVGAAPNRRGTAV
SFIPDSEIFGEQKFKPAKLYRLARSKAYLFAGVEIRWKCAPELIGDDTPPEAVFQFPGGL
ADHLKEQLGDRECATTQFFSGNQDFPGEAGRVEWAVAWPLWSDGSYSWYCNTIPTPDGGT
HENGLRAALVKGIRAFGELVGQKKAKDITADDIMTSSEIMLSVFIRDPQFQSQTKDRLTS
PDAARLVENAVRDHFDHFLTDHMDRGKALLAYVIDRMDERLKRKQEKEVKRKTATSARKL
RLPGKLTDCSNDDPEGAEIFLVEGDSAGGSAKQARDRKTQAILPLRGKILNVASANTAKI
LANQEIADMILALGCGTRKDCNPDNLRYERIVIMTDADVDGAHIATLLMTFFFQEMPELV
RRGHLYLAQPPLYRLTAGGKSLYAMDDAQREAMLAKEFKGKKVEISRFKGLGEMNPMQLR
ETTMDPKTRSLIRITLPDDIEDRQQVRDLVERLMGTNPAHRFAFIQENAAAIDEEAIDA