Protein Info for GFF345 in Sphingobium sp. HT1-2

Annotation: Molybdenum ABC transporter, substrate-binding protein ModA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13531: SBP_bac_11" amino acids 36 to 258 (223 residues), 171 bits, see alignment E=3.6e-54 TIGR01256: molybdate ABC transporter, periplasmic molybdate-binding protein" amino acids 39 to 257 (219 residues), 178.7 bits, see alignment E=7.8e-57 PF01547: SBP_bac_1" amino acids 39 to 250 (212 residues), 49.1 bits, see alignment E=8.3e-17

Best Hits

Swiss-Prot: 49% identical to MODA_XANAC: Molybdate-binding protein ModA (modA) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K02020, molybdate transport system substrate-binding protein (inferred from 74% identity to sjp:SJA_C1-33060)

Predicted SEED Role

"Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>GFF345 Molybdenum ABC transporter, substrate-binding protein ModA (Sphingobium sp. HT1-2)
MRFFSPIPLLLRALALLSLLLSPSWAAAQDKRGPLVLAAASLQESMNAAADAWARQGHAR
PVLSFAASSALARQIKAGAPADLFASADEDWMDDIQKAGFVARGSRADMAGNRLVLVAPA
GKPVRLRIGRNMPLAAALNGGRLAMADPDAVPAGKYGKAALTALNVWPSVADKVARGDSV
RAALALVERGATPFGIVYATDARASKSVQTVGTFPTGSHPPIRYPVARLTASRHRDAEGF
RRFLLSAQGRAILGHYGFSAP