Protein Info for GFF3446 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Conjugative transfer protein TrbG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF03524: CagX" amino acids 56 to 275 (220 residues), 224.9 bits, see alignment E=4.3e-71 TIGR02775: P-type conjugative transfer protein TrbG" amino acids 57 to 264 (208 residues), 300.6 bits, see alignment E=2.5e-94

Best Hits

KEGG orthology group: K03204, type IV secretion system protein VirB9 (inferred from 86% identity to bmj:BMULJ_00883)

Predicted SEED Role

"Conjugative transfer protein TrbG" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>GFF3446 Conjugative transfer protein TrbG (Hydrogenophaga sp. GW460-11-11-14-LB1)
VEVVAVPQVLPMPAQMKPLPEALDKSTAPEPADERLRVSRANAEARVAPTREGYVNAIQV
WPYSDGALYQVYAAPGRVTVISLQAGEELVTVAAGDTVRWVVGDTSSGSGDVLRVNVLVK
PVRTGLKTNLVITTNRRTYLIELTSTEKAWMASVSWDYPKDRMLALQRQAQAAQTSAPVD
AGLSLERIRFRYAISGSTPPWKPLRAFDDGEKVYIQFPAGIAQGELPPLFVIGAQGDGQL
VNYRFRSPYYIVDRLFGAAELRLGADKGDLVRIERTDGVPPTARRD