Protein Info for GFF3445 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 18 to 43 (26 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details PF21088: MS_channel_1st" amino acids 144 to 184 (41 residues), 39.1 bits, see alignment 8.8e-14 PF00924: MS_channel_2nd" amino acids 185 to 252 (68 residues), 75.3 bits, see alignment E=5e-25 PF21082: MS_channel_3rd" amino acids 258 to 343 (86 residues), 58 bits, see alignment E=1.6e-19

Best Hits

KEGG orthology group: None (inferred from 99% identity to sek:SSPA1473)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>GFF3445 Putative inner membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MEYLARLNIVAMLMSTTFWINLAVVFFVTLITYWLINWLLNVVYKALQRPDKKDDAHGRL
RPIVFEMLKKTSKMLIFFAAFLFSLRFVALPDRLFSTLSHAWFLVVAIQMAIWLDQGVQS
WMRHLLYAPGSNKNPVTLVILGMILRVLVWSMMLLSILANVGVDITALVASLGVGGIAIA
LAVQTVLSDVFASLSIGFDKPFEIGDFVVFNDVAGTIEHIGLKTTRIRSLSGEQIVCANA
QLLQQTIHNYKRMQTRRIVFTFGVATATPPEKLRLIGDMVKKIITDVGETQFDRAHLLAF
GQDRLTYEVVHIVNTADYNKYMDIQQEINIRIIEKLIENDIELALPSLVVRAPVQVEETR
DYSNTADAKNADKRVMQ