Protein Info for GFF3444 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Nickel transport ATP-binding protein nikE2 (TC 3.A.1.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF00005: ABC_tran" amino acids 18 to 150 (133 residues), 65.4 bits, see alignment E=4.4e-22

Best Hits

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 97% identity to sty:STY1861)

Predicted SEED Role

"Nickel transport ATP-binding protein nikE2 (TC 3.A.1.5.3)" in subsystem Transport of Nickel and Cobalt (TC 3.A.1.5.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>GFF3444 Nickel transport ATP-binding protein nikE2 (TC 3.A.1.5.3) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLSCRDLVIRQGGKVLWQNLTFTISAGERVGIHAPSGTGKTTLGRVLAGWQKPTAGDVLL
DGSPLPLHQYCPVQLVPQHPELTFNPWRSAGDAVRDAWQPDPETMRRLHVQPEWLTRRPM
QLSGGELARIAILRALDPRTRFLIADEMTAQLDPSIQKAIWVYVLEVCRSRSLGMLVISH
QSALLDQVCTRHLQVE