Protein Info for GFF3441 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Nickel transport system permease protein nikB2 (TC 3.A.1.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 101 to 125 (25 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 288 to 314 (27 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 5 to 79 (75 residues), 27.6 bits, see alignment E=2.8e-10 PF00528: BPD_transp_1" amino acids 115 to 319 (205 residues), 141.1 bits, see alignment E=3.5e-45

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 99% identity to see:SNSL254_A1362)

Predicted SEED Role

"Nickel transport system permease protein nikB2 (TC 3.A.1.5.3)" in subsystem Transport of Nickel and Cobalt (TC 3.A.1.5.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>GFF3441 Nickel transport system permease protein nikB2 (TC 3.A.1.5.3) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKLFFSHFLRLIILLVLVAAGTFILLSFSPVDPIRAYIGNDLLHVPPEQYARIAARWGLD
QPLWERFGHWFWRLLQGDMGYSMLFNMPVASVIRERFATSFALLAGAWLLSGVLGVTLGF
LAGRFLHRWPDKMICRISYLLSSLPTFWIAMLLLALFAVRWPVLPVCCAWDPGNNAGTAL
LSERLRHLVLPVCALSLLGMGQIALHTREKIASVMKSEFIRFARAQGDKGWSLLRHQVLR
HAITPALCLQFASLGELMGGALLAEKVFAYPGLGQATIDAGLRGDVPLLMGIVLFCTLLV
FAGNTISAWLVVVLNRSLERPDAL