Protein Info for GFF3439 in Pseudomonas sp. DMC3

Annotation: HTH-type transcriptional regulator RutR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 PF00440: TetR_N" amino acids 24 to 70 (47 residues), 48 bits, see alignment 8.8e-17 PF08362: TetR_C_3" amino acids 71 to 212 (142 residues), 190.9 bits, see alignment E=1.1e-60

Best Hits

Swiss-Prot: 43% identical to RUTR_ECO57: HTH-type transcriptional regulator RutR (rutR) from Escherichia coli O157:H7

KEGG orthology group: K09017, TetR/AcrR family transcriptional regulator (inferred from 94% identity to pfo:Pfl01_0683)

Predicted SEED Role

"Transcriptional regulator RutR of pyrimidine catabolism (TetR family)" in subsystem Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>GFF3439 HTH-type transcriptional regulator RutR (Pseudomonas sp. DMC3)
MTFEVPAHGGKPASRIRQKNEETILKAAEDEFARHGFKGTSMNTIAQNAGLPKANLHYYF
TNKLGLYVAVLSNIIELWDSTFNTLTAEDDPAEALTRYIRAKMEFSRRQPQASRIFAMEV
ISGGECLSEYFNQDYRTWFTGRAAVFQAWIDAGKMDPVDPVHLIFLLWGSTQHYADFATQ
ICRVTGRSKLTKQDMEDAGNNLIRIILKGCGLTPSL