Protein Info for PS417_17595 in Pseudomonas simiae WCS417

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 54 to 77 (24 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 119 (108 residues), 76.4 bits, see alignment E=9.9e-26 PF00528: BPD_transp_1" amino acids 33 to 224 (192 residues), 103.7 bits, see alignment E=5.1e-34

Best Hits

Swiss-Prot: 36% identical to OCCQ_RHIRD: Octopine transport system permease protein OccQ (occQ) from Rhizobium radiobacter

KEGG orthology group: K10016, histidine transport system permease protein (inferred from 82% identity to pen:PSEEN1857)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UBU2 at UniProt or InterPro

Protein Sequence (233 amino acids)

>PS417_17595 amino acid ABC transporter permease (Pseudomonas simiae WCS417)
MNEFLNLHGYGPMLAQGAWMTLKLAFLALALSLALGLIAAAAKLSSAKWLRVPATLYTTL
IRSVPDLVLILLIFYSLQLWLNDLSEVFGWDYFEIDPFTAGVITLGFIYGAYFTENFRGA
ILSVPVGQLEAATAYGLSRWQRFHLVLFPQLMRFALPGLGNNWLVLLKSTALVSIIGLSD
LVKAAQNAGKTTNEPLYFLILAGLMYLVITTLSNRVLKRLERRYNLGIKGMAR