Protein Info for GFF3435 in Variovorax sp. SCN45

Annotation: predicted integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 52 to 75 (24 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details PF05425: CopD" amino acids 47 to 147 (101 residues), 33.4 bits, see alignment E=2.5e-12

Best Hits

KEGG orthology group: None (inferred from 89% identity to vpe:Varpa_0135)

Predicted SEED Role

"predicted integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (152 amino acids)

>GFF3435 predicted integral membrane protein (Variovorax sp. SCN45)
MSYVIALFIHLLCAAFWVGGMATMHFAVRPSAVATLEPPLRLRMMAATLRRFFVGVDASV
TLLFVSGVGMIMAAGGFRGLHWRIEAMMSIAIVMAAIYVYIRASVFRALRRAVEESAWPV
AAARLNTVRKLVMLNLALGVAVFAVATIGRAG