Protein Info for GFF3435 in Sphingobium sp. HT1-2

Annotation: Uncharacterized UPF0721 integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 6 to 33 (28 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 197 to 220 (24 residues), see Phobius details amino acids 226 to 249 (24 residues), see Phobius details PF01925: TauE" amino acids 12 to 243 (232 residues), 94.6 bits, see alignment E=3.8e-31

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 82% identity to sch:Sphch_0396)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>GFF3435 Uncharacterized UPF0721 integral membrane protein (Sphingobium sp. HT1-2)
MSPDLLYLACAIIAVIISGLAKGGFAGVGALAMPIMALGVDPVRGAAILLPILILQDAVS
VWAFRRSWDGHILAVMLPGMAIGVGLGYWFAAQVSETVVLGALGAISTLFGLQRLWVERG
GAIVLPSSSPGWVGTLFGIASGFTSQIAHAGSPPFQMWVLPKKLPRDMLVGTTAVAFAVM
NWMKVPAYAALGQFTHANLMATALLVPVAVVSTFAGVWLVRRVDAARFYTLIYVLMVLLG
LKLMADALIG