Protein Info for GFF3435 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Putative permease often clustered with de novo purine synthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 12 to 44 (33 residues), see Phobius details amino acids 59 to 84 (26 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details amino acids 240 to 265 (26 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 306 to 337 (32 residues), see Phobius details PF01594: AI-2E_transport" amino acids 14 to 341 (328 residues), 195.2 bits, see alignment E=8.4e-62

Best Hits

KEGG orthology group: None (inferred from 57% identity to mpt:Mpe_A3023)

Predicted SEED Role

"Putative permease often clustered with de novo purine synthesis" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>GFF3435 Putative permease often clustered with de novo purine synthesis (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPLTSNQIRALLWASIAVVIWLLLSLLAPVLMPFLLAAVLAYALHPLVERLHGKGVPRWL
GAGLAITLLMLVLLAVLLLIVPVITKQVPLLREQVPELLNRLNAWLTPLAGRFGVSLSVD
VNLVRGWLTKLVSGHEGEILESLLASLRIGGSALAAVFGNLFLMPIVAYYLLLDWDNLVE
RTKSLIPPRWRDSVQSFLDETDGVLGQYLRGQLLVMGVLAVFYTVALALVGLNLALPIGV
FTGLAVFVPYLGFGLGLVLALLAALLEFQTVLGVALVAAVYGVGQVVESLYLTPRLLGER
IGLHPIAVIFALLAFGHLFGFVGVLIALPASAVLLVAIRRLRQRYMASALYLDGPRAAPG
SPEA