Protein Info for GFF3431 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Alkanesulfonates transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 58 to 81 (24 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 117 to 134 (18 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 216 to 240 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 72 to 240 (169 residues), 60.2 bits, see alignment E=1.1e-20

Best Hits

KEGG orthology group: None (inferred from 43% identity to cti:RALTA_B1998)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>GFF3431 Alkanesulfonates transport system permease protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
VRIPPGAWLPLAIGAAWLLLIDTGAIAHPLMVPLHEVLAAPFIDEQGRQIWSAAASSLVR
VALGFLIGASLGIAVGVAVGLSRPAQLAVAPTVHGLRQVALFAWIPLLTAWFGNGDLVKI
VFISISTFFPVFLNTEQGVRGIAPAYREVAAIVRLGPWLRLRRLVLPAILPSVLTGVELA
LLTAWIGTVGSEYAIGTGRGIGAYLATARDVFRMDLVLIGVLVMALVGYGLSRFAQLLFL
RLIPWRPR