Protein Info for GFF3427 in Variovorax sp. SCN45

Annotation: FIG01006093: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 PF04828: GFA" amino acids 21 to 129 (109 residues), 77.3 bits, see alignment E=5.2e-26

Best Hits

KEGG orthology group: None (inferred from 77% identity to vpe:Varpa_0127)

Predicted SEED Role

"FIG01006093: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (169 amino acids)

>GFF3427 FIG01006093: hypothetical protein (Variovorax sp. SCN45)
MSTTSNPSPDQAGDGWQLPWTGGCRCGQVRLRISAPPLLSMACHCTGCQAMSASAFSLSL
AIPAQGFEVVSGEPVVGGLHGAESHHFFCPHCKSWMFTRTEGLDYFVNLRPSMLDRHAWV
EPFVETWTDEKLPWATTPAKHSFGALPAMDAFPALIEAYAREGARPAKG