Protein Info for GFF3427 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Probable lipoprotein envE precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00652: Ricin_B_lectin" amino acids 56 to 164 (109 residues), 72.9 bits, see alignment E=2.9e-24 PF14200: RicinB_lectin_2" amino acids 99 to 147 (49 residues), 29 bits, see alignment E=1.4e-10

Best Hits

Swiss-Prot: 100% identical to ENVE_SALTY: Probable lipoprotein EnvE (envE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 97% identity to sew:SeSA_A1328)

Predicted SEED Role

"Probable lipoprotein envE precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>GFF3427 Probable lipoprotein envE precursor (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTLLSGKTTLVLCLSSILCGCTTNGLPTPYSINLSFPVITQNQINSGGYYINDAEQIRTT
DGLCLDAGPDQQNRLTLRECKHVQSQLFSFHRDRITQGEKCLDAAGQGTKEGTPIILYSC
TGNDNQRWLTDDNKIKGKQSRKCLGTNSIIVRKGDPVVLADCDFSRALEFTIR