Protein Info for GFF3422 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: SSU ribosomal protein S20p

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 99 TIGR00029: ribosomal protein bS20" amino acids 13 to 94 (82 residues), 79.6 bits, see alignment E=1e-26 PF01649: Ribosomal_S20p" amino acids 13 to 92 (80 residues), 88.9 bits, see alignment E=1.4e-29

Best Hits

Swiss-Prot: 93% identical to RS20_RHOFT: 30S ribosomal protein S20 (rpsT) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K02968, small subunit ribosomal protein S20 (inferred from 93% identity to rfr:Rfer_2122)

MetaCyc: 46% identical to 30S ribosomal subunit protein S20 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S20p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (99 amino acids)

>GFF3422 SSU ribosomal protein S20p (Hydrogenophaga sp. GW460-11-11-14-LB1)
MATKPKKKNPRLASGRKRVRQDVKINAANTSLRSKYRTAVKNVEKAVLTGDKAKATELFA
KMQKVVDIVADKGIFHKNKAARDKSRLSAKVKGLAAAAA