Protein Info for PS417_17495 in Pseudomonas simiae WCS417

Annotation: multidrug ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 109 to 134 (26 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details TIGR03861: alcohol ABC transporter, permease protein" amino acids 5 to 257 (253 residues), 471.9 bits, see alignment E=2.7e-146 PF01061: ABC2_membrane" amino acids 11 to 225 (215 residues), 117.7 bits, see alignment E=8.4e-38 PF12698: ABC2_membrane_3" amino acids 62 to 250 (189 residues), 69.6 bits, see alignment E=4e-23 PF12679: ABC2_membrane_2" amino acids 80 to 253 (174 residues), 32.3 bits, see alignment E=9.6e-12

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 91% identity to pfl:PFL_2206)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U8Q3 at UniProt or InterPro

Protein Sequence (263 amino acids)

>PS417_17495 multidrug ABC transporter permease (Pseudomonas simiae WCS417)
MNAYWQCLRGIVLREWLRFVLQRTRFLSALVRPLLWLLVFAAGFRAALGISVIEPYDTYI
PYEVYIIPGLACMILLFNGMQGSLSMVYDREMGSMRVLLTSPLPRTFLLCSKLLATALIS
LLQVYGFLAIAWVYGVQPPAMGLLIALPALLLVALMLSALGLLLSNAIRQLENFAGVMNF
VIFPLFFLSSALYPLWKMRDSSEWLYWLCAINPFTHAVELVRFALYQRFAGLALAVCLGL
TVLFAVLAVLTFNPQHAALRKKG