Protein Info for GFF3419 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Ornithine carbamoyltransferase (EC 2.1.3.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR00658: ornithine carbamoyltransferase" amino acids 11 to 308 (298 residues), 351.1 bits, see alignment E=2.5e-109 PF02729: OTCace_N" amino acids 11 to 152 (142 residues), 156 bits, see alignment E=7.4e-50 PF00185: OTCace" amino acids 158 to 306 (149 residues), 174.2 bits, see alignment E=2.2e-55

Best Hits

Swiss-Prot: 82% identical to OTC_ACIAC: Ornithine carbamoyltransferase (argF) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: None (inferred from 83% identity to vpe:Varpa_1606)

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>GFF3419 Ornithine carbamoyltransferase (EC 2.1.3.3) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTAAPAMTIPHYLQFKDLDAATYAYLFERAAFIKRKFKAVEKYQPFADPDRTLAMIFEKA
STRTRVSFEAGMYQMGGSVVHLTTGDSQLGRAEPIEDSARVISRMVDIVMIRTFEQSKIE
AFAAHSRVPVINGLTNEFHPCQILADLFTFIERRGSIQGKVVAWVGDGNNMANTWLQAAE
LLGFTVHVSTPSGYEVDPVLAGIRNPDCYKVFKDPLEACAGAHLVTTDVWTSMGFEAENE
VRRAAFKRWCVDEDMMRTAQPDALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRMHVQ
KALMEYLLLGRLA