Protein Info for GFF3418 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 73 to 103 (31 residues), see Phobius details amino acids 145 to 171 (27 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 260 to 287 (28 residues), see Phobius details amino acids 308 to 331 (24 residues), see Phobius details PF12911: OppC_N" amino acids 71 to 108 (38 residues), 27.3 bits, see alignment 2.8e-10 PF00528: BPD_transp_1" amino acids 161 to 342 (182 residues), 108.9 bits, see alignment E=2.6e-35

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 82% identity to azc:AZC_2661)

Predicted SEED Role

"Putative glutathione transporter, permease component" in subsystem Utilization of glutathione as a sulphur source

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>GFF3418 hypothetical protein (Xanthobacter sp. DMC5)
MHGTDTFPTGALAAKSLAADAEDRAAAAALGAERAPATPTEPEFWPNVHAPDAARTVTAD
VARLAPVGRRHALLVFLSNPTAVAGLLILAVVVGAALAAPILFPDDPLEMAGRPLQWPGQ
NPRFPLGTDALGRDVLAGLVHGARVSLLVGACATLAGLLAGILVGATAGYFGGVVDDVLS
KLIEIFQTVPGFILLIVLVAIAQPSVPAIALAIAAVSWPQVARLVRAQFRAIKEKDFVAA
ARALGFGHGRIIFREILPNALPPVIVLASVTVATAILMESALSFMGLGDPNVVSWGSMIG
TGRDLLRTAWYLSAVPGVAIVLTVLSLNLIGDGLNEALNPRLGGEG