Protein Info for PS417_17480 in Pseudomonas simiae WCS417

Annotation: branched-chain amino acid ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR03863: ABC transporter, substrate binding protein, PQQ-dependent alcohol dehydrogenase system" amino acids 45 to 388 (344 residues), 500.4 bits, see alignment E=1.2e-154 PF13458: Peripla_BP_6" amino acids 57 to 355 (299 residues), 33.1 bits, see alignment E=2.6e-12

Best Hits

KEGG orthology group: None (inferred from 84% identity to pba:PSEBR_a2656)

Predicted SEED Role

"FIG00445410: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UK03 at UniProt or InterPro

Protein Sequence (390 amino acids)

>PS417_17480 branched-chain amino acid ABC transporter substrate-binding protein (Pseudomonas simiae WCS417)
MRQLAPYAVICLLAIAWAANGQAAEAPLQVQIGYLGYRPDPGPLLSNVIPEPADAGQRGA
ELAIIDSNSTGAFLNQRYSLTTATVDTPDALLAAAQAQHAQGLRLFVVNAPAASLRQLSA
ALPDSLLFNAGSPDDSLRSTACLGNVLHTLPSRAMLADALAQFLVVRKWQKALLIVGPTE
DDQAYAAALRRAAKRFGVQWVAEKAWRFDNDQRRSAQADMPLFTQTAEYDVVLVADERGD
FGEYVPYQTWYPRPVAGTQGLTPTGWHKTVETYGAAQLQKRFEALAGRWMNDRDFAAWMA
VRSIASAVSKLRQVEPMAIRQLEISEQLPLDGFKGRKLSYRPWNGQLRQPIPIVQPRALV
STSPQDGFLHPTNEMDSLGYDKPEVTCRFP