Protein Info for GFF3410 in Variovorax sp. SCN45

Annotation: Transcriptional regulator, AraC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 103 to 126 (24 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details PF12833: HTH_18" amino acids 287 to 370 (84 residues), 55.1 bits, see alignment E=7.7e-19 PF00165: HTH_AraC" amino acids 332 to 369 (38 residues), 29 bits, see alignment 9e-11

Best Hits

Predicted SEED Role

"transcriptional regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>GFF3410 Transcriptional regulator, AraC family (Variovorax sp. SCN45)
VPPVPTTPLLDAALRGVLLALLLVLALVFGRDRPRLPVARVGVLLALGLCVQVIGSTPMF
EASVPRLWQSPFVAVSVGNAVLFWVFAQALFDDDFELRPLHVAAWLAAAALAALNCAVVA
GSASVLAPVTTGLQRAVPLVFAVLAALAAATRWRADLVEGRRRLRMFIVVAGVGYSVGML
AVRLASPRGQLSDSSATADVVIMLLIVAVVAWRMLRLTRSDLFPVARAPAVIPAVMPDRP
ASPLPVEEPAEPELAPDSAEDRLAQSLQHAMAVEHAYRREDLSIATLASLLSAPEYRLRR
LINQRLGHRNFNAFVNGFRLAEAMAALADSSKRELPVLTIALTAGFQSIGPFNRAFKAAT
GLTPTEFRKQKLADS