Protein Info for PS417_17435 in Pseudomonas simiae WCS417

Annotation: dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 591 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR03075: PQQ-dependent dehydrogenase, methanol/ethanol family" amino acids 26 to 556 (531 residues), 799.3 bits, see alignment E=8.3e-245 PF13360: PQQ_2" amino acids 85 to 237 (153 residues), 61.1 bits, see alignment E=2e-20 amino acids 470 to 538 (69 residues), 39.8 bits, see alignment E=6.5e-14 PF01011: PQQ" amino acids 95 to 127 (33 residues), 27.9 bits, see alignment (E = 2.2e-10) amino acids 145 to 180 (36 residues), 27.1 bits, see alignment 3.8e-10 amino acids 502 to 538 (37 residues), 37.4 bits, see alignment 2.1e-13 PF13570: PQQ_3" amino acids 114 to 162 (49 residues), 22.2 bits, see alignment 2.4e-08 amino acids 480 to 520 (41 residues), 23.9 bits, see alignment 6.7e-09

Best Hits

Swiss-Prot: 53% identical to EXAA_PSEAE: Quinoprotein alcohol dehydrogenase (cytochrome c) (exaA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00114, alcohol dehydrogenase (cytochrome c) [EC: 1.1.2.8] (inferred from 95% identity to pba:PSEBR_a2665)

MetaCyc: 53% identical to alcohol dehydrogenase (cytochrome c550) monomer (Pseudomonas aeruginosa)
RXN-11333 [EC: 1.1.2.8]

Predicted SEED Role

"Quino(hemo)protein alcohol dehydrogenase, PQQ-dependent (EC 1.1.99.8)" (EC 1.1.99.8)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.2.8, 1.1.99.8

Use Curated BLAST to search for 1.1.2.8 or 1.1.99.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UBR3 at UniProt or InterPro

Protein Sequence (591 amino acids)

>PS417_17435 dehydrogenase (Pseudomonas simiae WCS417)
MTQPARRQPFALSVLLGAILLSGQAMASVTDEEILQDPKNPGQIVTNGLGVQGQRYSPLD
TLNVDNVKELRPVWAFSFGGEKQRGQQAQPMIKDGVMYLTGSYSRVFAVDARTGKKLWQY
DARLPDDIRPCCDVINRGVALYGDLVFFGTLDAKLVALNKDTGKVVWSKKVADHKEGYSI
SAAPLVINGKLITGVAGGEFGVVGKIEAYDPKNGELLWSRPTVEGHMGYVYKDGKAVENG
ISGGEAGKTWPGDLWKTGGAAPWLGGYYDPETNLLLFGTGNPAPWNSHLRPGDNLYSSSR
LALNPDDGTIKWHFQTTPHDGWDYDGVNELVSFNYTEGGKEIKAAATADRNGFFYVLDRT
NGKFIRGFPFVDKITWATGLDKDGRPIYNDASRPGAPGSEAKGTSVFVAPAFLGAKNWMP
MAYNRDTGLFYVPSNEWGMDMWNEGIAYKKGAAFLGAGFTIKPLNEDYIGVLRAIDPKTG
KEVWRHKNFAPLWGGVLTTKGNLVFTGTPEGFLQAFNAKTGEKVWEFQTGSGVLGSPVTW
EMDGEQYVSVLSGWGGAVPLWGGEVAKRIKDFNQGGMLWTFKLPKELVAKH