Protein Info for GFF3404 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: ABC transporter, periplasmic spermidine putrescine-binding protein PotD (TC 3.A.1.11.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF02030: Lipoprotein_8" amino acids 8 to 104 (97 residues), 35.3 bits, see alignment E=1.5e-12 PF01547: SBP_bac_1" amino acids 40 to 284 (245 residues), 69.4 bits, see alignment E=1.4e-22 PF13416: SBP_bac_8" amino acids 42 to 312 (271 residues), 142.6 bits, see alignment E=5.5e-45 PF13531: SBP_bac_11" amino acids 42 to 284 (243 residues), 58.2 bits, see alignment E=2.8e-19 PF13343: SBP_bac_6" amino acids 78 to 321 (244 residues), 110.7 bits, see alignment E=2.1e-35

Best Hits

Swiss-Prot: 100% identical to POTD_SALTI: Spermidine/putrescine-binding periplasmic protein (potD) from Salmonella typhi

KEGG orthology group: K11069, spermidine/putrescine transport system substrate-binding protein (inferred from 100% identity to seh:SeHA_C1337)

MetaCyc: 94% identical to spermidine preferential ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]; 7.6.2.11 [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"ABC transporter, periplasmic spermidine putrescine-binding protein PotD (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>GFF3404 ABC transporter, periplasmic spermidine putrescine-binding protein PotD (TC 3.A.1.11.1) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKKWSRHLLAAGALALGMSAAHASDNDTLYFYNWTEYVPPGLLEQFTKETGIKVIYSTYE
SNETMYAKLKTYKDGAYDLVVPSTYYVDKMRKEGMIQKIDKSKLTNFHNLDPEMLNKPFD
PNNDYSVPYIWGATAIGVNSDAIDPKTITSWADLWKPEYKNSLLLTDDAREVFQMALRKL
GYSGNTTDPKEIEAAYEELKKLMPNVAAFNSDNPANPYMEGEVNLGMVWNGSAFVARQAG
TPLEVVWPKEGGIFWMDSLAIPANAKNKEGALKLINFLLRPDVAKEVAETIGYPTPNLAA
RKLLSPEVANDKSLYPDAQTISKGEWQNDVGDASAIYEEYYQKLKAGR