Protein Info for GFF3401 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Lipoprotein releasing system transmembrane protein LolE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 21 to 48 (28 residues), see Phobius details amino acids 270 to 294 (25 residues), see Phobius details amino acids 315 to 342 (28 residues), see Phobius details amino acids 378 to 399 (22 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 4 to 413 (410 residues), 544.4 bits, see alignment E=1.8e-167 TIGR02213: lipoprotein releasing system, transmembrane protein LolE" amino acids 5 to 414 (410 residues), 755.4 bits, see alignment E=1.4e-231 PF12704: MacB_PCD" amino acids 27 to 239 (213 residues), 67 bits, see alignment E=3e-22 PF02687: FtsX" amino acids 274 to 407 (134 residues), 63.7 bits, see alignment E=1.8e-21

Best Hits

Swiss-Prot: 92% identical to LOLE_ECOLI: Lipoprotein-releasing system transmembrane protein LolE (lolE) from Escherichia coli (strain K12)

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 100% identity to seg:SG1902)

MetaCyc: 92% identical to lipoprotein release complex - inner membrane subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolE"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>GFF3401 Lipoprotein releasing system transmembrane protein LolE (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MASPLSLLIGLRFSRGRRRGGMVSLISVISTIGIALGVAVLIVGLSAMNGFERELNNRIL
AVVPHGEIEAVNQPWTNWREALAKVQKVPGIAAAAPYINFTGLVESGANLRAIQVKGVDP
KQEQQLSALPSFVQNHAWDHFKAGEQQIIIGKGVADALNVKQGDWVSIMIPNANADHKLL
QPKRVRLHVIGILQLSGQLDHSFAMIPLEDAQQYLDMGSSVSGIALKVHDVFNANKLVRD
AGEVTNSYVYIKSWIGTYGYMYRDIQMIRAIMYLAMILVIGVACFNIVSTLVMAVKDKSG
DIAVLRTLGAKDGLIRAIFVWYGLLAGLLGSLIGVAIGVVVSLQLTAIINGIEKAIGHQF
LSGDIYFIDFLPSELHWLDVVYVLVTALLLSLLASWYPARRASNIDPARVLSGQ