Protein Info for GFF3400 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 263 to 288 (26 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 278 (271 residues), 107.8 bits, see alignment E=2.7e-35

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 61% identity to bpt:Bpet1127)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>GFF3400 High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTDFFNYLFNGFLQGQIYALLALGFMVIYRASKVFNFAQGELMMLGAYAVWTLTLGANLP
PWLAIPLAFVCALVYGWLIERLFFERLVGESVFSMVMVTIGLVILIRGIVLVVWGAADRQ
FPVLLPPTPFIVGDMIFPSSLVIGAILTLVVTVGMSWFFNRTRAGLTLTAVAEEPTTAIS
LGISVKRAVTLAWMMGSVIATAGAIVLLSGRSLTVGTADVALAALPVALLAGLESIGGLI
LAGAIVGIVQALVAAYVDPAIGGSASSIVPFVFMLLILLVRPTGLFGWRHVERV