Protein Info for GFF3399 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 22 to 41 (20 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 149 to 150 (2 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 256 to 284 (29 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 50 to 312 (263 residues), 123.9 bits, see alignment E=3.6e-40

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 59% identity to bpt:Bpet1128)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>GFF3399 Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDPSGIFFTSHAGDRSLIRTRAQWVCLAALLLVLATLPWWASDRWVSIGYTTFITAVAVI
GLQICTGYAGQINLGQSAFMGVGAYGAALAMSAGWDALAALLIGGAGAALFGVMFGLTAA
RIKGFYLALTTIAAQALFHFLVLNLPQAWLGGAGGLHVESATALGISLNNDRAIYGFSFI
VLVVMTIGAFGIVRSRHGRSFEAVRDDDVAAGMMGIPVAATKARAFLVSAFYAGVAGGLW
VVALRHVSVEQFTLFNAIWMIAMMIVGGLGSIVGALIGTVLIQLAREGVTSLGPSVIQWV
PAVGQDFVFAAMNVLLGTVIILFLLFEPKGVMHRVQITKQAYRLWPFPY