Protein Info for GFF3397 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 623 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 55 to 83 (29 residues), see Phobius details amino acids 95 to 112 (18 residues), see Phobius details amino acids 118 to 135 (18 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 385 to 402 (18 residues), see Phobius details amino acids 408 to 426 (19 residues), see Phobius details amino acids 436 to 463 (28 residues), see Phobius details amino acids 473 to 493 (21 residues), see Phobius details amino acids 505 to 523 (19 residues), see Phobius details PF13515: FUSC_2" amino acids 399 to 516 (118 residues), 74.4 bits, see alignment E=9.3e-25 PF11744: ALMT" amino acids 407 to 525 (119 residues), 22.5 bits, see alignment E=5e-09

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (623 amino acids)

>GFF3397 hypothetical protein (Sphingobium sp. HT1-2)
MTMDRTMASWAMGWVSRRTAPTTVRLAARWLELRSIGLAPEHFSLAEGCRAALAVGVPLA
IAVSFGRAALGWAVFAAFWTCLCDAPGPDRLRRRLLLLFVVCGTLVTLAGAWGASAGAMA
GMIIGPALVFLSIVGGSRVAWSGPLGTLLAVVGVVAVGFPRPLDNALFQAGAFSAGSAWA
YLLINALWRLDPAAPLRQLADAVTARLLDMSGDLATIGDSRHRDEQWHSEHAAHRRAVRL
SIERLRGLIAPYARDPGVTAPLLRLLDTAETIFGALIALDQAFIDHIGPAPQRVATARAV
RVALLAWRSSMRAGEAGRKTRHRAVKRLRRTEGRLSDNLCIGCVRAIAQALDAFDAHPTD
LPIITRTADLATAPATGWRQACRQALRQSAGLMAVYYTAIVFRLGYPYWAAMAVVVVLQG
GARVTWTRCLERILGSLLGGCIALLVLHVATAPAVLAGLAIGLAGTAVSLRSVNYTVFVA
FLTMLFILVTELLQPGAGIASARMLDNVIGSIAALLAVLLLWPDFGASPTERIRSGIAAN
HAYVAAVEAARPIGEIEAARRAAGLASTEAEVALHDLGTTVRRFHVSSEDRASIAALRRL
AGDAAIAWHRRLAAAKAPPEESC