Protein Info for GFF3395 in Xanthobacter sp. DMC5

Annotation: putative protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF23023: Anti-Pycsar_Apyc1" amino acids 1 to 236 (236 residues), 76.5 bits, see alignment E=4.2e-25 PF00753: Lactamase_B" amino acids 15 to 178 (164 residues), 37.8 bits, see alignment E=3e-13 PF12706: Lactamase_B_2" amino acids 52 to 220 (169 residues), 64.5 bits, see alignment E=1.6e-21

Best Hits

KEGG orthology group: None (inferred from 73% identity to xau:Xaut_3325)

Predicted SEED Role

"Ribonuclease Z (EC 3.1.26.11)" in subsystem tRNA processing (EC 3.1.26.11)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>GFF3395 putative protein (Xanthobacter sp. DMC5)
MKLKVVGCGDAFGSGGRGNSCYHVETDGHVATLDFGASSLVQMHRFGIDSSGFHQVFISH
LHGDHFGGLPFLLLDGQFVHRRTTPLTIIGPPGIKVRLNAAMEVLFPKMATNDWRFDFEV
KEVEPGSTSQHGPLTLTTAQVIHASGAPSTALRITDGKRTLAFSGDTEWTDALLPIADGA
DLFICECFAFAGSPHGHMAYETIAAKRVALGAKHILLTHMGDEMWARRDEVDKTHFTVAE
DGLELSI