Protein Info for PS417_17365 in Pseudomonas simiae WCS417
Updated annotation (from data): galactaro-1,5-lactonase
Rationale: Specifically important in carbon source D-Galacturonic Acid monohydrate. This is the second step after D-galacturonate dehydrogenase (PS417_17360) and forms meso-galactarate, which is the substrate of PS417_04210. The substrate is probably the 1,5-lactone, not the 1,4-lactone, given the characterization of the D-galacturonate dehydrogenase from Agrobacterium tumefaciens (PMID:24450804), which is 51% identical to PS417_17360.
Original annotation: gluconolactonase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 93% identity to pfs:PFLU3950)Predicted SEED Role
"Gluconolactonase (EC 3.1.1.17)" in subsystem Entner-Doudoroff Pathway (EC 3.1.1.17)
MetaCyc Pathways
- glucose degradation (oxidative) (5/5 steps found)
- Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
- glucose and glucose-1-phosphate degradation (4/5 steps found)
- L-ascorbate biosynthesis VIII (engineered pathway) (5/7 steps found)
- sorbitol biosynthesis II (2/3 steps found)
- Entner-Doudoroff pathway II (non-phosphorylative) (6/9 steps found)
- L-ascorbate biosynthesis IV (animals, D-glucuronate pathway) (3/6 steps found)
- L-ascorbate biosynthesis VI (plants, myo-inositol pathway) (1/4 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 3.1.1.17
Use Curated BLAST to search for 3.1.1.17
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7TYW3 at UniProt or InterPro
Protein Sequence (291 amino acids)
>PS417_17365 galactaro-1,5-lactonase (Pseudomonas simiae WCS417) MNAELIVDARNAVGECPVWVPGENALYWVDIPKGGLQRWSAATGHVAAWTAPQMLACIAR TDAGNWVAGMETGFFQLTPHNDGSLDTTLLAAVEHPRQDMRLNDGRCDRQGRFWAGSMVL NMGLNAAEGTLYRYTSGAAPHAQLDGFITLNGLAFSPDGRTMYASDSHPLVQQIWAFDYD IDTGTPSNRRVFVDMHKHLGRPDGAAVDADGCYWICANDAGLIHRFSPDGRLDRSLTVPV KKPTMCAFGGSRLDTLFVTSIRDDQSEQSLSGGVFALNPGVVGLPEPTFTL