Protein Info for GFF3392 in Sphingobium sp. HT1-2

Annotation: Mercuric ion reductase (EC 1.16.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 TIGR02053: mercury(II) reductase" amino acids 13 to 472 (460 residues), 526.4 bits, see alignment E=3.8e-162 PF07992: Pyr_redox_2" amino acids 13 to 324 (312 residues), 227.1 bits, see alignment E=1.3e-70 PF12831: FAD_oxidored" amino acids 14 to 73 (60 residues), 29.6 bits, see alignment E=1.8e-10 PF01134: GIDA" amino acids 14 to 66 (53 residues), 29.8 bits, see alignment 1.3e-10 PF13738: Pyr_redox_3" amino acids 140 to 312 (173 residues), 38.9 bits, see alignment E=2.6e-13 PF00070: Pyr_redox" amino acids 181 to 253 (73 residues), 58.4 bits, see alignment E=3.4e-19 PF02852: Pyr_redox_dim" amino acids 348 to 456 (109 residues), 101 bits, see alignment E=1.8e-32

Best Hits

Swiss-Prot: 45% identical to MERA_PSEFL: Mercuric reductase (merA) from Pseudomonas fluorescens

KEGG orthology group: K00520, mercuric reductase [EC: 1.16.1.1] (inferred from 63% identity to mmr:Mmar10_2329)

Predicted SEED Role

"Mercuric ion reductase (EC 1.16.1.1)" in subsystem Mercuric reductase or Mercury resistance operon (EC 1.16.1.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.16.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (472 amino acids)

>GFF3392 Mercuric ion reductase (EC 1.16.1.1) (Sphingobium sp. HT1-2)
MNDCCNRPGQEGFDVAVIGAGSAGYSAAIAAADLGAKVALVGHGTIGGTCVNVGCVPSKT
LIRAAEAVHGGLAAARFPGLGGAVQMDDWSVLAASKDDLVTTLRQKKYVDLLPAYDGVSY
IEGKARFADGALIVGDAPMKVGKVILAMGAHAAVPPIPGMDSVPYLTSTSALALDRLPKS
LLVIGGGVIGVELGQMFSRLGVDVTICCRSRLLPEMDPEVSAALKNYLEAEGVRVCAGVG
YQRIAQTQSGVELTCEGHCDTVAAEQVLIATGRRPNSDGLGLEERGIVLARNGGIVVDDH
LETSVPGIYAAGDVTGRDQFVYMAAYGAKLAARNAVTGNQYRYDNSSMPSVVFTDPQVAS
AGLTETTARAQGLDIKVSLLPLDAVPRALAARDTRGLIKLIADKANDRLLGGQIMAPEGA
DSIQTLVLAIKHGMTTLELGATIFPYLTTVEGLKLAAQTFDKDVAKLSCCAG