Protein Info for GFF3391 in Xanthobacter sp. DMC5

Annotation: Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF02277: DBI_PRT" amino acids 21 to 337 (317 residues), 381.8 bits, see alignment E=1.4e-118 TIGR03160: nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase" amino acids 24 to 337 (314 residues), 369 bits, see alignment E=1.2e-114

Best Hits

Swiss-Prot: 69% identical to COBT_SINFN: Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (cobT) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K00768, nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC: 2.4.2.21] (inferred from 92% identity to xau:Xaut_3321)

MetaCyc: 68% identical to nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase subunit (Pseudomonas denitrificans (nom. rej.))
Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase. [EC: 2.4.2.21]

Predicted SEED Role

"Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (EC 2.4.2.21)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.4.2.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>GFF3391 Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (Xanthobacter sp. DMC5)
MFPQDPGSPFDDIRQLVATLPGPNEGAREAALARQEQLVKPPGALGRLEAIAAHLSAWQG
NSMPTVNRPMVAVFAATHGVADLGVSPYPGEVTKQMMATFTAGKAAVNQICATFDAGLRV
FDLALDYPTPDITTNAALDEKACAATMAFGMEAIAGGSDLLCLGEMGIGNTTVAAAICHG
LYGGTAEEWVGAGTGAAGEVLERKIAAVRAAVAFHKEHLSDPLEVLRRLGGREIAAIAGA
IIAARHEKVPVVLDGFVVTAAAAVLHAMNPNALDHCLAGHVSAEKAHRQLLDRLGLVPLL
DLGMRLGEGSGAALSIGVVKAAVACHRGMATFAEAGVSEG