Protein Info for GFF3390 in Variovorax sp. SCN45

Annotation: Transcriptional activator of acetoin dehydrogenase operon AcoR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 641 PF26965: MimR_N" amino acids 15 to 171 (157 residues), 30.1 bits, see alignment E=1.1e-10 PF00158: Sigma54_activat" amino acids 336 to 500 (165 residues), 211.2 bits, see alignment E=2.6e-66 PF14532: Sigma54_activ_2" amino acids 341 to 508 (168 residues), 54.2 bits, see alignment E=5.9e-18 PF25601: AAA_lid_14" amino acids 511 to 585 (75 residues), 55.3 bits, see alignment E=1.5e-18 PF02954: HTH_8" amino acids 597 to 633 (37 residues), 34.4 bits, see alignment 4.4e-12

Best Hits

KEGG orthology group: None (inferred from 86% identity to vap:Vapar_0077)

Predicted SEED Role

"Transcriptional activator of acetoin dehydrogenase operon AcoR" in subsystem Acetoin, butanediol metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (641 amino acids)

>GFF3390 Transcriptional activator of acetoin dehydrogenase operon AcoR (Variovorax sp. SCN45)
MTSLQSRHIDNVYSIATGAALADPTQSLVHKSWARCVRDHGLDPSKPTPARILPAQEVRA
HQQQLEHFLRAARAGMEDIYRRVADLGYMVLLTDAEGITVDYIGNPAWDDQLRKAGLYLG
ADWNEAHAGTCGVGTCLVERQPMTCHQTEHFDATHIALTCTTAPLFDHSGKLTAILDVSA
LRSPEAKESQHLVRHLVSMYARMIEDADFLRNFRGHWILRLGSAFGLVDVAGEVMLAFDD
GGTLAGANGGARQAFAGHALSGAVSELLHMPMDAIWRIGNGGAISPLMPFAHTVLLPGGG
EYHASLIAPRSRRAQAPATAAPSARPSDRLPPLERIAGDDPAMQKLLAQARRLVDRGIHV
LVEGETGSGKEVLARALHSASSRAAMPFVAVNCAAIPDSLIESELFGYTPGSFTGGRAKG
MKGLIAQADRGTLFLDEIGDMPMALQTRLLRVLSEGEVLPLGAESPQRVDIAVVAATHRH
LPGLVASGRFREDLYYRLCGAVLKLPPLRARGDMRYLIEGMFNEEAAAMPSPARLSEEAM
QRLLAHDWPGNLRELRNALRLALALCTGASVSAQDLQLQARADTVCDTEPDEDVAAEARR
LLDALKRHRWRVAHAADELGMSRATAYRHMKRLGIVVPRRG