Protein Info for PS417_17340 in Pseudomonas simiae WCS417

Annotation: GNAT family acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00583: Acetyltransf_1
  • amino acids 49 to 122 (74 residues), 34.7 bits, E=2.8e-12
• PF13673: Acetyltransf_10
  • amino acids 50 to 128 (79 residues), 51.1 bits, E=2e-17
• PF13508: Acetyltransf_7
  • amino acids 52 to 123 (72 residues), 53.6 bits, E=3.6e-18

Best Hits

Swiss-Prot: 47% identical to YJAB_SALTY: Peptidyl-lysine N-acetyltransferase YjaB (yjaB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03827, putative acetyltransferase [EC: 2.3.1.-] (inferred from 70% identity to pfo:Pfl01_3445)

MetaCyc: 48% identical to peptidyl-lysine N-acetyltransferase YjaB (Escherichia coli K-12 substr. MG1655)
2.3.1.-

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

See A0A1N7U0Y8 at UniProt or InterPro

Protein Sequence (155 amino acids)

>PS417_17340 GNAT family acetyltransferase (Pseudomonas simiae WCS417)
MTIRPRVPTDDPVLGALWERSVRATHDFLPEDDIQRLLPLVRDTYLPMPALDVWVYEDPH
GIAGFIGTGGHNVEMLFIEPDRRGQGIGRQLLDHARARHDTLTVDVNEQNPQAVGFYLHY
GFIQVARSPLDGEGKPFPLLHMALPTPDPEGIEQC