Protein Info for GFF3386 in Sphingobium sp. HT1-2

Annotation: Superoxide dismutase [Mn] (EC 1.15.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF02777: Sod_Fe_C" amino acids 134 to 234 (101 residues), 80.9 bits, see alignment E=3.1e-27

Best Hits

Swiss-Prot: 53% identical to SODM_CUPMC: Superoxide dismutase [Fe] (chrC) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 67% identity to sal:Sala_1781)

Predicted SEED Role

"Superoxide dismutase [Mn] (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>GFF3386 Superoxide dismutase [Mn] (EC 1.15.1.1) (Sphingobium sp. HT1-2)
VTIDHLSRRSAIATLGIGAAAMTINEASAQTPAAAPAAVPAFAGNHQVKPLRFNPARLHG
LSERLITSHHENNYAGSVKALNMIETRLAAALADTDLPPVVYGGLKREELHRTGSVVLHE
VYFDGLGGNGQAAGSIRDALGAAFGSFDRWEADFRRTGMSLAGGSGWCVLVYNLHTRSLH
NHWAWDHMHGAIAGVPLLALDMYEHSFHMDYGTAAAKYVDAFFRNIDWEVVDRRYAAALR
GGG