Protein Info for GFF3386 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: BatA (Bacteroides aerotolerance operon)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 329 to 351 (23 residues), see Phobius details PF07584: BatA" amino acids 7 to 80 (74 residues), 33.4 bits, see alignment E=7.2e-12 PF00092: VWA" amino acids 93 to 184 (92 residues), 26.1 bits, see alignment E=1.4e-09 amino acids 230 to 312 (83 residues), 24.8 bits, see alignment E=3.6e-09 PF13519: VWA_2" amino acids 93 to 182 (90 residues), 59.6 bits, see alignment E=6.6e-20

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 74% identity to pna:Pnap_3247)

Predicted SEED Role

"BatA (Bacteroides aerotolerance operon)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>GFF3386 BatA (Bacteroides aerotolerance operon) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNHWPVTFLWPQLLWLLLALPLLVLLYVWLLRRRKQAALRYASLSIVREAMGKGPGWRRH
VPPVLLLMAIAVMLLASARPMATIVLPSTQQTIILAMDVSGSMRAEDVKPNRLVASQNAA
KAFLAELPRHVKVGIVAFAGSAQVVQPVTLSREDLVTAIDKFQLQRATAIGSAIVVSLSE
LFPEQRINLGDMTYSRNTDPFAPKGRSLDQPKPDEKTFTPVAPGSYTSAAIILLTDGQRT
TGVDTAEAAKMAAERGVRVYTVGVGTVDGEIIGFEGWSMRVRLDEESLKEVARTTQAEYY
YAGTAENLKKVYETLSSRLTVEKKETEISGLLALAASLLALLSAGLSVLWFNRIL