Protein Info for GFF3385 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative OMR family iron-siderophore receptor precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 724 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF07715: Plug" amino acids 73 to 173 (101 residues), 67.5 bits, see alignment E=1.4e-22 TIGR01783: TonB-dependent siderophore receptor" amino acids 75 to 724 (650 residues), 538.3 bits, see alignment E=1.5e-165 PF00593: TonB_dep_Rec_b-barrel" amino acids 278 to 695 (418 residues), 175 bits, see alignment E=5.3e-55

Best Hits

Swiss-Prot: 81% identical to FHUE_ECOLI: FhuE receptor (fhuE) from Escherichia coli (strain K12)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 82% identity to eum:ECUMN_1280)

MetaCyc: 81% identical to ferric coprogen/ferric rhodotorulic acid outer membrane transporter (Escherichia coli K-12 substr. MG1655)
RXN0-1702

Predicted SEED Role

"Putative OMR family iron-siderophore receptor precursor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (724 amino acids)

>GFF3385 Putative OMR family iron-siderophore receptor precursor (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSFIQYRRDKHLPSTAAPSLLAMGMAMAFMPAAFAAEDTVIVEGETTADAVNREEQDYSM
KTTAAGTKMPMTQRDIPQSVSIVSQQRMEDQQLQTLGEVMTNTLGISGSQADSDRISYYS
RGFEIDNYMVDGIPTYFESRWNLGDALTDTALYERVEVVRGANGLMTGTGNPSASINMIR
KHATSREFKGNVSTEYGSWNKQRYVMDLQSPLTADGNVRGRIVAGYQNNDSWLDRYNSEK
AFFSGIVDADLGTTTNLSAGYEYQKIDVNSPTWGGLPRWNTDGSKNSYDRARSTAPDWAY
NNKEINKFFVTLKQRFAESWQATLNATHTEVKFDSKMMYIDALVDKETGTLVSPYGASYP
VVGGTGWNSGKRKVDAIDLFADGAYELFGRQHNMMFGGSYSKQNNRYFSAWANVFPDDIG
NFSAFNGNFPQTHWAPQNLAQDDTTHMKSLYAATRISLADPLHLILGARYTNWRVDTLTY
SMEKNHTTPYAGLIYDINDNWSAYASYTSIFQPQNKRDKAGQYLAPITGNNYEAGLKSDW
MNSRLTTTLSVFRIEQNNVAQATTIPIPGSNGEFAWKSTDGTVSKGVEFEVNGAITDNWQ
MTFGATRYVAEDNEGNAVNPNLPRTSVKLFTRYRLPAIPELTVGGGVNWQNRVYKDTTTP
YGTFRAEQGSYALVDLFTRYQVTKNFSVQGNINNLFDKTYDTNIDGSIVYGAPRNVSLTA
NYQF